PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000288624
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 328aa    MW: 36544.9 Da    PI: 6.7809
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000288624genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM48.82.2e-15666162
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFs 62
                   lpp f F Ptdeelv +yL +k +g+ +el e+i+evd+yk+eP+dLp + + ++++  fF 
  MDP0000288624  6 LPPXFIFYPTDEELVAYYLDRKXNGRXIEL-EIIPEVDLYKCEPRDLPGTERYGTERSEFFE 66
                   6899**************************.99***************43333444445554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-16368IPR003441NAC domain
PROSITE profilePS5100516.3566154IPR003441NAC domain
PfamPF023653.3E-5759IPR003441NAC domain
SMARTSM003200.03291131IPR001680WD40 repeat
Gene3DG3DSA:2.130.10.101.4E-5597300IPR015943WD40/YVTN repeat-like-containing domain
CDDcd002003.82E-5497300No hitNo description
PfamPF004000.01897130IPR001680WD40 repeat
PROSITE profilePS5008210.44298140IPR001680WD40 repeat
SuperFamilySSF509783.21E-5398301IPR017986WD40-repeat-containing domain
PROSITE profilePS5029438.70598254IPR017986WD40-repeat-containing domain
PRINTSPR003203.2E-6118132IPR020472G-protein beta WD-40 repeat
SMARTSM003202.8E-5134173IPR001680WD40 repeat
PfamPF004003.1E-5138173IPR001680WD40 repeat
PROSITE profilePS5008215.388141182IPR001680WD40 repeat
PRINTSPR003203.2E-6160174IPR020472G-protein beta WD-40 repeat
SMARTSM003201.6E-9176215IPR001680WD40 repeat
PfamPF004003.6E-8178215IPR001680WD40 repeat
PROSITE profilePS5008214.986183224IPR001680WD40 repeat
PRINTSPR003203.2E-6202216IPR020472G-protein beta WD-40 repeat
SMARTSM003201.0E-7218257IPR001680WD40 repeat
PfamPF004001.0E-8221254IPR001680WD40 repeat
PROSITE profilePS5008210.709225254IPR001680WD40 repeat
SMARTSM003206.4271305IPR001680WD40 repeat
PfamPF004000.22273300IPR001680WD40 repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAPMSLPPXF IFYPTDEELV AYYLDRKXNG RXIELEIIPE VDLYKCEPRD LPGTERYGTE  60
RSEFFEIRNG TTIITVLIIQ NNISHSSSLN LWCGSEEFVA HSAAVNCLKI GRKSSRVLVT  120
GGEDHKVNLW AIGKPNALLS LSGHTSGIDS VSFDSSEVLV AAGAASGTIK LWDLEEAKIV  180
RTLTGHRSNC ISVDFHPFGE FFASGSLDTN LKIWDIRKKG CIHTYKGHTR GVNAIRFTPD  240
GRWVVSCGED NTVKTTYKLK SIISQLWDLT AGKMLHDFKC HEGQVQCIDF HPHEFLLATG  300
LNLIDDNQKP YGYKKISGIT LAMTSCQT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1vyh_C3e-2511430295410PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_D3e-2511430295410PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_G3e-2511430295410PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_H3e-2511430295410PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_K3e-2511430295410PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_L3e-2511430295410PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_O3e-2511430295410PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_P3e-2511430295410PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_S3e-2511430295410PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
1vyh_T3e-2511430295410PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008340409.11e-132PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2
RefseqXP_008350805.11e-138PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog
RefseqXP_008350806.11e-138PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog
RefseqXP_009351775.11e-133PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X3
SwissprotQ8H0T91e-123KTNB1_ARATH; Katanin p80 WD40 repeat-containing subunit B1 homolog
TrEMBLA0A067GP111e-130A0A067GP11_CITSI; Katanin p80 WD40 repeat-containing subunit B1 homolog
STRINGPOPTR_0010s26190.11e-129(Populus trichocarpa)
STRINGPGSC0003DMT4000564461e-129(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.14e-25NAC domain containing protein 20